PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10020451m
Common NameCICLE_v10020171mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 402aa    MW: 44725.5 Da    PI: 7.4827
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10020451mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.1e-3446100155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Ciclev10020451m  46 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 100
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.01443103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-3144101IPR009057Homeodomain-like
SuperFamilySSF466898.24E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2346101IPR006447Myb domain, plants
PfamPF002494.7E-104899IPR001005SANT/Myb domain
PfamPF143791.3E-23147193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MYHHHQNQGK SMHSSSRMPI PTERHLFLQG GSGPGDSGLV LSTDAKPRLK WTPDLHERFI  60
EAVNQLGGAD KATPKTVMKL MGIPGLTLYH LKSHLQKYRL SKNLHGQANI GNNKIGPVTV  120
PGERMPEANA THMNNLSIGP QPNKSLHISE TIQMQIEVQR RLHEQLEVQR HLQLRIEAQG  180
KYLQAVLEKA QETLGRQNLG TAGLEAAKVQ LSELVSKVST QCLNSTFSDL KELQGFCPQQ  240
PQANQPTDCS MDSCLTSCEG SQKDQEIHNG GVRLRPYHGT PTLEPKEIVE EPMLQQTELK  300
WRKDLKESKF LSSIGKDRGP GELSIGSGSF PAGRFKASNE DEHFQDQTNK KPEGAKLENE  360
NLLPEYRLPC FSTKLDLNAH DHENDVASGC KQFDLNGFSW N*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443380.10.0hypothetical protein CICLE_v10020171mg
RefseqXP_006479082.10.0PREDICTED: uncharacterized protein LOC102612777
RefseqXP_006479083.10.0PREDICTED: uncharacterized protein LOC102612777
TrEMBLA0A067EIU20.0A0A067EIU2_CITSI; Uncharacterized protein
TrEMBLV4TY190.0V4TY19_9R
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-165G2-like family protein